Web Analysis for Heavyweightsandskinnyjeans - heavyweightsandskinnyjeans.com
3.13
Rating by CuteStat
heavyweightsandskinnyjeans.com is 6 years 7 months old. It is a domain having com extension. It has a global traffic rank of #15824183 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, heavyweightsandskinnyjeans.com is SAFE to browse.
PageSpeed Score
88
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | 30 |
Daily Pageviews: | 60 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 15,824,183 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 54.72.9.51)
HTTP Header Analysis
HTTP/1.1 403 Forbidden
Server: nginx
Date: Sun, 01 Oct 2017 20:41:26 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=5
Vary: Accept-Encoding
Content-Encoding: gzip
Server: nginx
Date: Sun, 01 Oct 2017 20:41:26 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=5
Vary: Accept-Encoding
Content-Encoding: gzip
Domain Information
Domain Registrar: | Tucows Domains Inc. |
---|---|
Registration Date: | Sep 30, 2017, 12:00 AM 6 years 7 months 1 week ago |
Last Modified: | Sep 30, 2017, 12:00 AM 6 years 7 months 1 week ago |
Domain Status: |
ok
|
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.parkingcrew.net | 13.248.158.159 | United States of America | |
ns2.parkingcrew.net | 76.223.21.9 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
heavyweightsandskinnyjeans.com | A | 595 |
IP: 54.72.9.51 |
heavyweightsandskinnyjeans.com | NS | 3599 |
Target: ns2.parkingcrew.net |
heavyweightsandskinnyjeans.com | NS | 3599 |
Target: ns1.parkingcrew.net |
heavyweightsandskinnyjeans.com | SOA | 10799 |
MNAME: ns1.parkingcrew.net RNAME: hostmaster.heavyweightsandskinnyjeans.com Serial: 1506890000 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 86400 |
heavyweightsandskinnyjeans.com | MX | 3599 |
Priority: 10 Target: exchange.dewile.net |
heavyweightsandskinnyjeans.com | MX | 3599 |
Priority: 5 Target: mail.h-email.net |
heavyweightsandskinnyjeans.com | TXT | 3599 |
TXT: v=spf1 ip6:fd1b:212c:a5f9::/48 -all |
Similarly Ranked Websites
Auto enrolment guide - How to get auto enrolment off your desk
- autoenrolmentguide.net
Auto enrolment guide - how to get auto enrolment off your desk. This auto enrolment guide is a low-cost solution for small businesses in the UK.
15,824,223
$
8.95
Rumah Kantor
- rumahkantor.com
kursi kantor, meja kantor, kursi kantor bandung, meja kantor bandung
15,824,231
$
8.95
Full WHOIS Lookup
Domain Name: HEAVYWEIGHTSANDSKINNYJEANS.COM
Registry Domain ID: 2169341706_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2017-09-30T21:06:09Z
Creation Date: 2017-09-30T21:06:09Z
Registry Expiry Date: 2018-09-30T21:06:09Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.PARKINGCREW.NET
Name Server: NS2.PARKINGCREW.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-10-01T20:41:09Z
Registry Domain ID: 2169341706_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2017-09-30T21:06:09Z
Creation Date: 2017-09-30T21:06:09Z
Registry Expiry Date: 2018-09-30T21:06:09Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.PARKINGCREW.NET
Name Server: NS2.PARKINGCREW.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-10-01T20:41:09Z